10-08-2011, 02:44 PM
To perform Multiple alignments between the following sequences-.docx (Size: 125.1 KB / Downloads: 39)
Sequence 1:
>gi|44955888|ref|NP_976312.1| myoglobin [Homo sapiens]
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi|21359820|ref|NP_038621.2| myoglobin [Mus musculus]
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi|11024650|ref|NP_067599.1| myoglobin [Rattus norvegicus]
MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRYSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 4:
>gi|27806939|ref|NP_776306.1| myoglobin [Bos taurus]
MGLSDGEWQLVLNAWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAEVKHLAESHANKHKIPVKYLEFISDAIIHVLHAKHPSDFGADAQAAMSKALELFRNDMAAQYKVLGFHG
Theory:
• Multiple sequence alignment is the alignment of more than two nucleic acid or protein sequences that is a set of sequences at once (unlike pairwise alignment where two sequences are compared).
• Multiple nucleotide or protein sequence alignment techniques are usually performed to fit one of the following scopes :
In order to characterize protein families, identify shared regions of homology in a multiple sequence alignment; (this happens generally when a sequence search revealed homologies to several sequences).
Determination of the consensus sequence of several aligned sequences. Help prediction of the secondary and tertiary structures of new sequences.
To infer evolutionary relationships between genes, and to discover patterns that are shared among groups of functionally or structurally related sequences.
Procedure:
• Respective protein sequences of Human (NP_976312.1), Mouse (NP_038621.2), Rat (NP_067599.1) and Bovine (NP_776306.1) in Fasta format were retrieved from NCBI (www.ncbi.nlm.nih.gov).
• Log in to http://www.ebi.ac.uk/Tools/clustalw2/
• Paste the respective sequences in the given input boxes.
• Keep all the option buttons in default.
• Click run.
• Results were displayed as soon as the given job completed.